The short version of ICP-MS fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-10-03 and is reviewed periodically as new material appears.
Published studies describe the complex in several research contexts, including collagen synthesis, antioxidant behaviour, and wound repair models. Much of this work is conducted in cultured cells or in small animal systems, and the findings are frequently cited in reviews of copper peptides. Direct clinical evidence in humans is comparatively limited, and reported outcomes vary with formulation and study design. Whether free chain or metal-bound form was used is not always stated, a point that complicates comparison between reports.
GHK-Cu is a coordination complex formed between the peptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The unbound chain, abbreviated GHK, consists of three amino acids and occurs naturally in human plasma, saliva, and urine. Binding of the metal is mediated mainly by the imidazole nitrogen of the histidine residue together with backbone amides, producing a stable chelate. Ingredient nomenclature often lists the same substance as copper tripeptide-1. Its charge and solubility behaviour differ from those of the metal-free chain.
The peptide sequence places a histidine in the middle, and this residue dominates metal binding. Copper(II) coordinates through the imidazole nitrogen of histidine and the terminal amino group, forming a stable chelate ring system. Loss of the copper ion leaves the free tripeptide, which has different solubility and reactivity. This structural detail matters because assays that measure only the peptide backbone can miss whether copper is still bound to it.
Several names circulate for the same material, which complicates literature searches. Cosmetic ingredient lists often use copper tripeptide-1, while older biochemistry papers use glycyl-L-histidyl-lysine or its abbreviation GHK. The copper complex is sometimes written as GHK-Cu(II) to make the oxidation state explicit. Terminology is not fully standardized, so matching a compound across sources requires attention to the exact sequence, the counterion, and the stated copper content. Reviews that compare studies must account for these naming differences before drawing conclusions.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Copper(II) peptide complex | Coordination compound rather than a simple salt |
| Peptide sequence | Glycyl-L-histidyl-L-lysine | Abbreviated GHK in most literature |
| Molecular formula | C14H22N6O4Cu | Reported for the 1:1 complex |
| Principal binding site | Histidine imidazole nitrogen | Backbone amides contribute additional coordination |
| Common synonym | Copper tripeptide-1 | Used in ingredient and product labelling |
Practical handling notes centre on limiting exposure to water, oxygen, and repeated temperature cycling. Weighed powder is often equilibrated to room temperature before opening to avoid condensation on the solid. Working solutions are typically divided into single-use aliquots and frozen rather than stored refrigerated for long periods. Reported shelf lives vary widely between laboratories, and no single set of conditions is universally treated as a reference standard, which complicates direct comparison of published stability figures.
Solutions of GHK-Cu respond strongly to pH, redox conditions, and the presence of competing chelators such as EDTA. Below roughly pH 4 the copper tends to dissociate, because the amide nitrogen donors become protonated and can no longer coordinate. Strongly alkaline conditions instead favour hydrolysis and precipitation of copper hydroxide. Dissolved oxygen and light accelerate breakdown of the peptide backbone, and the copper released during that process can catalyse further oxidation, so dry, cold, dark storage is the usual recommendation.
Stability of GHK-Cu is influenced by light, oxygen, moisture, pH, and temperature. Solid material is generally kept desiccated and frozen to reduce hydrolysis and oxidation, while aqueous solutions are best prepared fresh or stored cold in aliquots. Repeated freeze-thaw cycles can promote aggregation, precipitation, or peptide degradation. Copper coordination may change under strongly acidic or alkaline conditions, potentially altering the complex's spectroscopic properties. Published long-term stability data for specific matrices, such as cosmetic emulsions or biological buffers, are limited, so shelf-life claims should be treated as formulation-specific rather than universal.
Quality control for GHK-Cu relies on documentation and independent testing rather than a single accepted standard. A certificate of analysis may report peptide purity, copper content, residual solvents, water content, and microbial limits, but the underlying methods and acceptance criteria vary by supplier. Verification can include mass confirmation, amino acid analysis, and comparison with a reference standard when one is available. Open questions include how different copper-binding modes or peptide isomers affect measured activity and whether conventional purity assays capture those differences. Buyers of research-grade material typically need to request raw data rather than rely solely on a summary certificate.
Laboratory characterization of GHK-Cu typically combines separation, spectroscopic, and elemental techniques. Reverse-phase high-performance liquid chromatography is widely used to assess peptide purity, often with ultraviolet detection near the copper-related absorption band or with mass spectrometry for identity confirmation. Because the molecule contains copper, elemental methods such as inductively coupled plasma mass spectrometry or atomic absorption spectroscopy are used to quantify metal content and confirm stoichiometry. No single universal pharmacopeial monograph exists for GHK-Cu. Laboratories therefore validate their own methods, and reported purity values depend on the chosen assay and calibration standards.
Laboratory studies describe GHK-Cu as a source of copper that cells can take up, with reported effects on collagen, elastin, and glycosaminoglycan synthesis in cultured fibroblasts. The peptide also appears in wound-repair research, where it is linked to the activity of matrix metalloproteinases and their inhibitors. These observations come largely from cell and animal models. How directly the complex controls any single pathway in intact human skin remains an open question, and reported effects depend on concentration, vehicle, and exposure time.
Copper takes part in redox chemistry, and the same property that makes it useful in enzymes can generate reactive oxygen species when the ion is loosely bound. GHK chelates copper through imidazole, amino, and amide nitrogen donors, which reduces the amount of free copper in solution. Whether that chelation is protective, neutral, or harmful in a given tissue is not settled. Laboratory assays report both antioxidant and pro-oxidant behavior, depending on the conditions and the readout used.
Published work on GHK-Cu is dominated by in vitro experiments and small animal studies. Human trials tend to be short and small, with endpoints such as skin appearance rather than clinical outcomes. Review articles often summarize the same underlying laboratory findings, which can make the evidence base look broader than it is. Several basic questions remain open: the concentration of the intact complex in human tissue, the route by which it crosses the skin barrier, and whether effects seen in culture produce measurable changes in people.
The compound was first isolated from human plasma by the biochemist Loren Pickart in 1973. Early work identified it as a factor that altered the behavior of cultured liver cells, and later studies linked it to connective tissue and wound-related processes. Reported plasma concentrations fall markedly between roughly age twenty and age sixty, a pattern that generated interest in copper peptide biology. Whether that decline has functional consequences remains an open question, because differences observed across age groups do not by themselves establish causation. Research interest later expanded into cosmetic and tissue-culture settings.
Mechanistic accounts focus on how the complex delivers copper and how the released peptide interacts with the extracellular matrix. Copper is an essential cofactor for lysyl oxidase and other enzymes involved in collagen and elastin cross-linking, and GHK is one of several peptides able to carry the metal. Reported effects include altered gene expression in fibroblasts and changes in matrix metalloproteinase activity, although many of these findings come from cell culture rather than whole organisms. The relative contribution of the peptide backbone, the copper ion, and downstream copper metabolism is not fully resolved.
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-lysine and a copper(II) ion. The peptide sequence is conventionally written as Gly-His-Lys, abbreviated GHK. Copper binds through the imidazole nitrogen of histidine, the alpha-amino group, and a deprotonated amide nitrogen, producing a square-planar geometry. The complex carries a net positive charge near physiological pH and is intensely blue in aqueous solution. The metal-free peptide is often written simply as GHK, while the copper-bound form is written GHK-Cu.
ATC code H01 Pituitary and hypothalamic hormones and analogues is a therapeutic subgroup of the Anatomical Therapeutic Chemical Classification System, a system of alphanumeric codes developed by the World Health Organization (WHO) for the classification of drugs and other medical products. Subgroup H01 is part of the anatomical group H Systemic hormonal preparations, excluding sex hormones and insulins. Codes for veterinary use (ATCvet codes) can be created by placing the letter Q in front of the human ATC code: for example, QH01. ATCvet codes without corresponding human ATC codes are cited with the leading Q in the following list.National versions of the ATC classification may include additional codes not present in this list, which follows the WHO version. H01AA01 Corticotropin H01AA02 Tetracosactide H01AB01 Thyrotropin alfa H01AC01 Somatropin H01AC02 Somatrem H01AC03 Mecasermin H01AC04 Sermorelin H01AC05 Mecasermin rinfabate H01AC06 Tesamorelin H01AC07 Somapacitan H01AC08 Somatrogon H01AC09 Lonapegsomatropin H01AX01 Pegvisomant QH01AX90 Capromorelin
The Department of Mines and Petroleum was a department of the Government of Western Australia until it was superseded by the Department of Mines, Industry Regulation & Safety on 1 July 2017. The department was formed on 1 January 2009, out of the former Department of Industry & Resources and Department of Consumer & Employment Protection, which were split into three new departments, the Department of Mines & Petroleum, the Department of State Development and the Department of Commerce. Its focus is the resources sector, maintaining a mining and petroleum regulatory role and incorporating the resources safety responsibilities from the former Department of Consumer & Employment Protection. It also oversees the Geological Survey of Western Australia. The department operates the Mindex website, a continuously updated database containing information on mines, mineral deposits and prospects in Western Australia.
Bismuth is included in bismuth strontium calcium copper oxide, which is a group of similar superconducting compounds discovered in 1988 that exhibit the highest superconducting transition temperatures. Bismuth telluride is a semiconductor and an excellent thermoelectric material. Bi2Te3 diodes are used in mobile refrigerators, CPU coolers, and as detectors in infrared spectrophotometers. Bismuth oxide, in its delta form, is a solid electrolyte for oxygen. This form normally breaks down below a high-temperature threshold, but can be electrodeposited well below this temperature in a highly alkaline solution. Bismuth germanate is a scintillator, widely used in X-ray and gamma ray detectors. Bismuth vanadate is an opaque yellow pigment used by some artists' oil, acrylic, and watercolor paint companies, primarily as a replacement for the more toxic cadmium sulfide yellows in the greenish-yellow (lemon) to orange-toned yellow range. It performs practically identically to the cadmium pigments, such as in terms of resistance to degradation from UV exposure, opacity, tinting strength, and lack of reactivity when mixed with other pigments. The most commonly used variety by artists' paint makers is lemon in color. In addition to being a replacement for several cadmium yellows, it also serves as a nontoxic visual replacement for the older chromate pigments made with zinc, lead, and strontium. If a green pigment and barium sulfate (for increased transparency) are added, it can also serve as a replacement for barium chromate, which possesses a more greenish cast than the others.
=== Pharmacodynamics === Dasiglucagon elevates blood glucose levels in normal and hypoglycemic conditions. In adult patients with type 1 diabetes, the average increase in glucose levels at 90 minutes after dasiglucagon administration was 168 mg/dL. For pediatric patients aged seven to 17 years with type 1 diabetes, the mean glucose increase at 60 minutes post-administration was 162 mg/dL. A study conducted on Danish patients with type 1 diabetes (T1DM) compared the pharmacological effects of dasiglucagon with glucagon. Dasiglucagon reached its maximum plasma concentration later than glucagon (35 minutes vs. 20 minutes) across different doses. The time for patients to recover glycemic levels above 70 mg/dL was similar between dasiglucagon (≥0.3 mg) and glucagon (0.5 mg and 1 mg) groups. Dasiglucagon rapidly increased plasma glucose (PG) levels in a dose-dependent manner, reaching a maximum concentration in approximately 50-90 minutes. The glycokinetic response of dasiglucagon was 2-4 times higher than that of glucagon. Dasiglucagon had a higher overall effect than GlucaGen at certain dose levels. In children with T1DM (7 to 17 years old), dasiglucagon showed a faster increase in blood glucose levels by 160 mg/dL or more from baseline at an earlier time (about 30 min) than in adults. Due to the limited number of patients aged 65 years and older enrolled in phase 3 trials, it was impossible to determine if these patients' responses differed from those of young adults.
Sources: en.wikipedia.org
=== Judgment-based === A metalloid is an element that possesses a preponderance of properties in between, or that are a mixture of, those of metals and nonmetals, and which is therefore hard to classify as either a metal or a nonmetal. This is a generic definition that draws on metalloid attributes consistently cited in the literature. Difficulty of categorisation is a key attribute. Most elements have a mixture of metallic and nonmetallic properties, and can be classified according to which set of properties is more pronounced. Only the elements at or near the margins, lacking a sufficiently clear preponderance of either metallic or nonmetallic properties, are classified as metalloids. Boron, silicon, germanium, arsenic, antimony, and tellurium are commonly recognised as metalloids. Depending on the author, one or more from selenium, polonium, or astatine are sometimes added to the list. Boron sometimes is excluded, by itself, or with silicon. Sometimes tellurium is not regarded as a metalloid. The inclusion of antimony, polonium, and astatine as metalloids has been questioned. Several other elements are occasionally classified as metalloids. These elements include hydrogen, beryllium, nitrogen, phosphorus, sulfur, zinc, gallium, tin, iodine, lead, bismuth, radon, flerovium, moscovium, livermorium, tennessine, and oganesson. However, due to relativistic effects and short half-lives, Fl to Og are hard to place into metalloids.
=== Contestants === 1st - Karl Fong, Bakery Owner from Hercules, California 2nd - Jessica Brockway, Bakery Owner from Seattle, Washington 3rd - Pete Tidwell, Bakery Owner from Provo, Utah 4th - Julie Montgomery, Pastry Instructor from Toronto, Canada 5th - Jocelyn Jung, Bakery Owner from San Diego, California 6th - Sheldon Taylor-Timothy, Home Baker from Toronto, Canada 7th - Brittany Lombardi, Pastry Cook from The Bronx, New York 8th - Jess Eddy, Bakery Owner from Hartland, Wisconsin
Vincent Marks (10 June 1930 – 6 November 2023) was an English pathologist and clinical biochemist known for his works on studying insulin and hypoglycemia. His contributions to medical science include simplifying low blood glucose testing, introducing insulin radioimmunoassay, and advancing diabetes research. Marks played an important role in high-profile medico-legal cases, notably providing expert testimony that helped acquit Danish-born British socialite Claus von Bülow in 1985, a case that was the basis of the Oscar-winning movie Reversal of Fortune (1990). Marks was also a nutritionist who studied intestinal hormones and coined the term "muesli belt malnutrition", referring to parents feeding their children what is considered extremely healthy foods, but, in the process depriving them of essential fats.
Sources: en.wikipedia.org
=== Publication bias === Publication bias is cited as a concern in the reviews of randomized controlled trials of acupuncture. A 1998 review of studies on acupuncture found that trials originating in China, Japan, Hong Kong, and Taiwan were uniformly favourable to acupuncture, as were ten out of eleven studies conducted in Russia. A 2011 assessment of the quality of randomized controlled trials on traditional Chinese medicine, including acupuncture, concluded that the methodological quality of most such trials (including randomization, experimental control, and blinding) was generally poor, particularly for trials published in Chinese journals (though the quality of acupuncture trials was better than the trials testing traditional Chinese medicine remedies). The study also found that trials published in non-Chinese journals tended to be of higher quality. Chinese authors use more Chinese studies, which have been demonstrated to be uniformly positive. A 2012 review of 88 systematic reviews of acupuncture published in Chinese journals found that less than half of these reviews reported testing for publication bias, and that the majority of these reviews were published in journals with impact factors of zero. A 2015 study comparing pre-registered records of acupuncture trials with their published results found that it was uncommon for such trials to be registered before the trial began. This study also found that selective reporting of results and changing outcome measures to obtain statistically significant results was common in this literature.
The Journal of Peptide Science is a monthly peer-reviewed scientific journal, published since 1995 by John Wiley & Sons on behalf of the European Peptide Society. The current editor-in-chief is Paolo Rovero (Universita di Firenze).
Christopher Cantelmo (June 19, 1962 – November 24, 2019) was an American biochemist. In 2019 he became known on Reddit under the username u/ChrisCGC for spending large sums on awards while promoting the use of DMT. The online activity around his posts was sometimes referred to as Cantelmoism.
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
Sources: en.wikipedia.org
GHK denotes the unbound chain of three amino acids. GHK-Cu describes the form in which a copper(II) ion is held by that chain. The two are not interchangeable in solution, since charge, molecular weight, and reactivity differ.
The chain occurs in human plasma, saliva, and urine. Measured amounts are reported to fall with age. Copper binding by the sequence is treated as part of normal metal handling in tissue.
The bound copper(II) centre contributes to redox behaviour and to stability under physiological conditions. Free copper ions can participate in reactions that generate reactive species, while chelated metal is generally more controlled. The chain may also serve as a carrier for copper in experimental systems.
The peptide is glycyl-L-histidyl-L-lysine, a three-amino-acid sequence commonly abbreviated GHK. It binds a single copper(II) ion under typical laboratory conditions. The free peptide and the copper complex are separate chemical species with different properties.