A practical reference on RP-HPLC: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-08-01. Anything still debated is marked as such rather than presented as settled.
GHK-Cu is the copper-binding complex formed by the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The free peptide is usually written as GHK, and the complex is written as GHK-Cu or Cu-GHK. The sequence was identified in human plasma and later detected in saliva and urine. Its name comes from the single-letter codes of glycine, histidine and lysine. The complex is widely described as a naturally occurring carrier of copper in blood rather than as a free peptide with its own hormonal role.
Copper binds to the peptide through the histidine imidazole nitrogen and the terminal amino group, forming a stable square-planar complex. Binding constants reported for copper(II) with GHK are high, so the peptide competes effectively for copper in solution. The complex absorbs visible light, which gives solutions a blue to violet colour. Whether the metal-free peptide has a distinct biological function of its own is still an open question; some work treats it mainly as a copper delivery vehicle, while other work reports peptide-specific effects.
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The peptide binds copper through its histidine imidazole nitrogen, its terminal amino group, and a deprotonated amide nitrogen, creating a stable chelate ring. The resulting complex carries a distinctive blue to blue-violet color, which arises from copper d-d electronic transitions. In the solid state it is usually handled as a powder, while in solution the complex can dissociate and re-form depending on pH and competing ligands. The name copper tripeptide-1 is widely used in ingredient listings.
The tripeptide was first isolated from a human plasma filtrate in 1973 during studies of tissue repair factors. Later work detected the free peptide and its copper complex in saliva, urine, and wound fluid, suggesting a natural role in tissue remodeling. Plasma concentrations reported in early literature decline with age, a pattern often cited in discussions of skin aging. Whether these endogenous levels are directly functional or largely incidental remains an open question. The peptide sequence is conserved across mammalian species.
| Property | Value | Notes |
|---|---|---|
| Sequence | Gly-His-Lys | Three amino acids; histidine supplies the main copper-binding nitrogen |
| Bound metal | Copper(II) | Coordination is described as square-planar around the metal centre |
| Appearance | Blue to violet solid | Colour originates from copper d-d electronic transitions |
| Solubility class | Freely soluble in water | Aqueous solutions are often slightly acidic |
| Common synonyms | Copper tripeptide, Cu-GHK | Ingredient lists may say only 'copper peptide' without giving the sequence |
GHK-Cu is a coordination complex formed from the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The peptide binds copper through its histidine imidazole nitrogen, the terminal amino group, and the deprotonated amide nitrogen. This arrangement creates a square-planar or distorted geometry around the metal center, depending on pH and the presence of competing ligands. The complex occurs naturally in human plasma, saliva, and urine at low concentrations, and its sequence is conserved across many vertebrate species.
Discovery of GHK is generally attributed to work in the 1970s that isolated a plasma factor influencing liver cell behavior. Subsequent studies identified the copper-binding tripeptide and its ability to chelate copper with high affinity. Early reports linked the complex to wound healing and tissue remodeling in animal models. The free peptide and the copper-bound form have different properties, so the two are distinguished in the literature. Whether endogenous GHK-Cu serves a single primary physiological role remains an open question.
Solid GHK-Cu appears as a blue to blue-violet powder, and the colour is a direct consequence of copper coordination. The complex dissolves readily in water and in many polar solvents, while the free peptide behaves differently. Solubility in nonpolar media is low, which limits its use in oil-based systems. Solutions are typically prepared fresh because the dissolved form is more exposed to hydrolysis and to loss of the metal ion than the dry powder. Working concentrations are usually low, and preparation notes often specify the solvent and the order of addition.
Dry material is typically held at low temperature, often around minus twenty degrees Celsius, and protected from moisture and light. Copper complexes can release their metal ion under acidic conditions or in the presence of competing chelators. Hydrolysis of the peptide backbone is a slower but real pathway, and the histidine residue is susceptible to oxidation over long periods. Stability statements therefore depend on formulation, pH, and container, and they should be read as conditional rather than absolute.
=== Environment === PMOS may also be impacted by epigenetics, which regulates how active genes are. High levels of androgens and AMH during pregnancy and early weight gain can hinder the fetal environment. In studies of PMOS in mice, exposure to AMH or the androgen dihydrotestosterone still has an effect three generations later. If that is so in humans, it implies that PMOS can be inherited via epigenetic changes. Blood in the umbilical cord of babies whose mothers have PMOS shows specific epigenetic changes suggestive of PMOS. There is little evidence on the effect of environmental pollutants on PMOS risk. Hormone disruptors are chemicals that disturb the hormonal system by blocking or mimicking natural hormones. Of these, bisphenol A and phthalates (both used in plastics), and possibly octocrylene exposure may raise the risks of PMOS. Obesity is implicated in PMOS development. As fat tissue can produce androgens, obesity leads to increased androgen levels. It also leads to suppression of the SHBG hormone, increased insulin resistance, and abnormally increased insulin levels. Some of the effects go both ways: PMOS might impact appetite, so that weight gain becomes more likely. Weight loss using diet is equally effective in people with and without PMOS.
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
Electric tweezers Transdermal electrolysis Transcutaneous hair removal Microwave hair removal Foods and dietary supplements Non-prescription topical preparations (also called "hair inhibitors", "hair retardants", or "hair growth inhibitors")
Sources: en.wikipedia.org
=== Onset and duration === The onset of action of psilocybin taken orally is 0.5 to 0.8 hours (30 to 50 minutes) on average, with a range of 0.1 to 1.5 hours (5 to 90 minutes). Peak psychoactive effects occur at about 1.0 to 2.2 hours (60 to 130 minutes). The time to offset of psilocybin orally is about 6 to 7 hours on average. The duration of action of psilocybin is about 4 to 6 hours (range 3–12 hours) orally. A small dose of 1 mg by intravenous injection had a duration of 15 to 30 minutes. In another study, 2 mg psilocybin by intravenous injection given over 60 seconds had an immediate onset, reached a sustained peak after 4 minutes, and subsided completely after 45 to 60 minutes.
=== Environmental and mechanical degradation of plastic === Indoor air, especially in carpeted buildings, contains high concentrations of degraded synthetic fibers, meaning potential exposure to office workers and custodial staff. Settled dust is ingested by adults and particularly children. In wastewater management, recycling facilities, and landfills, plastic goods undergo environmental (weathering) and mechanical degradation. Recycling facilities and landfills serve as reservoirs of particulates workers may potentially be exposed to.
In organic chemistry, an alkane, or paraffin (a historical trivial name that also has other meanings), is an acyclic saturated hydrocarbon. In other words, an alkane consists of hydrogen and carbon atoms arranged in a tree structure in which all the carbon–carbon bonds are single. Alkanes have the general chemical formula CnH2n+2 and therefore range in complexity from the simplest case of methane (CH4), where n = 1, to arbitrarily large and complex molecules, like hexacontane (C60H122) or 4-methyl-5-(1-methylethyl) octane, an isomer of dodecane (C12H26). The International Union of Pure and Applied Chemistry (IUPAC) defines alkanes as "acyclic branched or unbranched hydrocarbons having the general formula CnH2n+2, and therefore consisting entirely of hydrogen atoms and saturated carbon atoms". However, some sources use the term to denote any saturated hydrocarbon, including those that are either monocyclic (i.e. the cycloalkanes) or polycyclic, despite them having a distinct general formula (e.g. cycloalkanes are CnH2n). In an alkane, each carbon atom is sp3-hybridized with 4 sigma bonds (either C–C or C–H), and each hydrogen atom is joined to one of the carbon atoms (in a C–H bond). The longest series of linked carbon atoms in a molecule is known as its carbon skeleton or carbon backbone. The number of carbon atoms may be considered as the size of the alkane. One group of the higher alkanes are waxes, solids at standard ambient temperature and pressure (SATP), for which the number of carbon atoms in the carbon backbone is greater than about 17.
Sources: en.wikipedia.org
While personal and impersonal values often align, they can diverge, for example, if an individual seeks personal gain that is bad from a wider perspective. The exact relation between these two types of value is disputed. According to one proposal, impersonal value is the sum of all personal values. Well-being is typically understood as an intrinsic or final value, meaning that it is good in itself, independent of external factors. Things with instrumental value, by contrast, are only good as means leading to other good things, like the value of money. Well-being is further distinguished from moral, religious, and aesthetic values, which describe what is ethically right, sacred, or beautiful. Well-being may or may not overlap with other values. For instance, donating money to a charity may be morally good, even if it does not increase the donor's well-being. The terms quality of life, good life, welfare, prudential value, personal good, and individual utility are often used as synonyms for well-being. Similarly, the words pleasure, life satisfaction, and happiness are employed in overlapping ways with well-being. However, their precise meanings differ in technical contexts like philosophy and psychology: pleasure refers to individual feelings about what is attractive; life satisfaction is a positive attitude a person has towards their life as a whole; happiness is sometimes identified with life satisfaction or understood as a positive balance of pleasure over pain. Well-being is a crucial goal of many human endeavors on both individual and societal levels.
When total translated protein was run on an SDS-polyacrylamide gel electrophoresis and sucrose gradient, peaks corresponding to insulin and proinsulin were isolated. However, to the surprise of Weber a third peak was isolated corresponding to a molecule larger than proinsulin. After reproducing the experiment several times, he consistently noted this large peak prior to proinsulin that he determined must be a larger precursor molecule upstream of proinsulin. In May 1975, at the American Diabetes Association meeting in New York, Weber gave an oral presentation of his work where he was the first to name this precursor molecule "preproinsulin". Following this oral presentation, Weber was invited to dinner to discuss his paper and findings by Donald Steiner, a researcher who contributed to the characterization of proinsulin. A year later in April 1976, this molecule was further characterized and sequenced by Steiner, referencing the work and discovery of Hans Weber. Preproinsulin became an important molecule to study the process of transcription and translation. The first genetically engineered (recombinant), synthetic human insulin was produced using E. coli in 1978 by Arthur Riggs and Keiichi Itakura at the Beckman Research Institute of the City of Hope in collaboration with Herbert Boyer at Genentech. Genentech, founded by Swanson, Boyer and Eli Lilly and Company, went on in 1982 to sell the first commercially available biosynthetic human insulin under the brand name Humulin.
The concept of a steady state has relevance in many fields, in particular thermodynamics, economics, and engineering. If a system is in a steady state, then the recently observed behavior of the system will continue into the future. In stochastic systems, the probabilities that various states will be repeated will remain constant. For example, see Linear difference equation § Conversion to homogeneous form for the derivation of the steady state. In many systems, a steady state is not achieved until some time after the system is started or initiated. This initial situation is often identified as a transient state, start-up or warm-up period. For example, while the flow of fluid through a tube or electricity through a network could be in a steady state because there is a constant flow of fluid or electricity, a tank or capacitor being drained or filled with fluid is a system in transient state, because its volume of fluid changes with time. Often, a steady state is approached asymptotically. An unstable system is one that diverges from the steady state. See for example Linear difference equation#Stability. In chemistry, a steady state is a more general situation than dynamic equilibrium. While a dynamic equilibrium occurs when two or more reversible processes occur at the same rate, and such a system can be said to be in a steady state, a system that is in a steady state may not necessarily be in a state of dynamic equilibrium, because some of the processes involved are not reversible. In other words, dynamic equilibrium is just one manifestation of a steady state.
Sources: en.wikipedia.org
The letters GHK are the one-letter codes for glycine, histidine and lysine, the three amino acids in the peptide. The suffix Cu indicates that the peptide is bound to a copper ion, normally copper(II).
The free tripeptide and its copper complex have been measured in human plasma, saliva, urine and some tissue extracts. Reported concentrations vary widely between studies, and the role of the complex in normal physiology remains partly unresolved.
The plain peptide lacks the metal, so its charge, colour and binding behaviour differ. The copper complex is blue and carries a bound copper ion, while the metal-free form is colourless and has different solution chemistry.
It is a complex of the tripeptide glycyl-L-histidyl-L-lysine with a copper(II) ion. The peptide coordinates the metal through its histidine, amino terminus, and an amide nitrogen. It is often listed simply as copper tripeptide-1.